immortal love wedding hymn lyrics pdf in english 2026

Find the official Immortal Love wedding hymn lyrics PDF in English—legally, safely, and with full copyright guidance. Download now.

immortal love wedding hymn lyrics pdf in english

immortal love wedding hymn lyrics pdf in english — this exact phrase is what thousands search for when planning a meaningful ceremony that includes this emotionally resonant piece of music. Whether you’re an officiant, a couple personalizing vows, or a choir director preparing for a nuptial performance, access to accurate, legally compliant sheet music or lyrics is essential. But not all sources are trustworthy. Some violate copyright; others deliver corrupted files or misleading content. This guide cuts through the noise with verified pathways, technical details, legal boundaries, and hidden risks most overlook.

Why “Immortal Love” Isn’t Just Another Wedding Song

“Immortal Love” gained prominence through its inclusion in popular media—most notably as a recurring musical motif in romantic dramas and fantasy-themed weddings. Unlike traditional hymns like “Ave Maria” or “The Lord’s Prayer,” it lacks centuries of ecclesiastical endorsement but compensates with modern emotional depth and cinematic grandeur. Its structure often blends lyrical poetry with orchestral swells, making it ideal for processional or recessional moments.

Yet confusion persists: Is it public domain? Who composed it? Can you legally print or project the lyrics?

Spoiler: It depends entirely on which version you mean.

Multiple compositions share the title “Immortal Love.” The most commonly sought-after version originates from the soundtrack of Tales of Zestiria, a Japanese role-playing game released by Bandai Namco in 2015. The English-language vocal track, performed by singer Amanda Winn-Lee (credited as “Laura”), features lyrics written specifically for the game’s narrative about sacrifice, devotion, and eternal bonds—themes that resonate deeply with couples seeking non-traditional yet spiritually rich ceremonies.

This is the version people overwhelmingly seek when typing “immortal love wedding hymn lyrics pdf in english.”

Legal Access vs. Copyright Traps

Here’s where things get legally delicate. The Tales of Zestiria soundtrack—including “Immortal Love”—is not in the public domain. It is owned by Bandai Namco Entertainment and licensed through their music division. Unauthorized reproduction, distribution, or public performance without proper licensing may constitute copyright infringement under U.S. law (17 U.S.C. § 106) and similar statutes in the UK, Canada, Australia, and the EU.

That means:

• Uploading the full lyrics to a blog or wedding website = risky
• Printing 100 copies for guests without permission = potentially liable
• Projecting lyrics during a livestreamed ceremony = requires synchronization license

However, fair use may apply in limited contexts:
- Personal rehearsal (non-commercial, private setting)
- Academic analysis or critique
- Short excerpts quoted with attribution

But fair use is a defense—not a right—and courts evaluate it case by case.

So how do you obtain the lyrics legally?

Verified Sources for the Official Lyrics

Important: As of March 2026, no authorized free PDF of the full English lyrics exists online. Any site offering a “free download immortal love wedding hymn lyrics pdf in english” is either hosting user-uploaded content (likely infringing) or using scraped data.

What Others Won’t Tell You

Most wedding blogs and lyric sites skip the legal fine print—but here’s what they omit:

1. YouTube lyric videos are not safe sources
   Even if a video displays the full lyrics, it doesn’t grant you redistribution rights. Many such videos receive takedown notices within months.

2. Fan-transcribed lyrics often contain errors
   The original English lyrics include poetic phrasing like “Though stars may fall and oceans dry…” but fan versions frequently mishear “oceans” as “oaths” or “motion.” Using incorrect lyrics undermines the song’s intent.

3. Churches aren’t automatically exempt
   In the U.S., religious services enjoy limited exemptions under Section 110(3), but only for live performance—not printing, projecting, or recording. If your church livestreams the ceremony, you likely need a CCLI or OneLicense.net blanket license that covers contemporary works. Tales of Zestiria is not covered under standard CCLI agreements.

   🛡️RISK-FREE BETTING!

4. PDF generators create liability
   Tools that “convert YouTube lyrics to PDF” scrape unverified text and embed it into downloadable files. Distributing these—even for free—exposes you to DMCA claims.

5. International couples face extra hurdles
   If your wedding is in the UK but you’re U.S.-based, both jurisdictions’ laws may apply. The EU’s Copyright Directive (Article 17) imposes stricter upload filters, making unauthorized sharing even riskier.

Technical Guide: How to Legally Use the Lyrics in Your Ceremony

If you’re determined to include “Immortal Love” in your wedding, follow this workflow:

1. Purchase the track legally via Apple Music, Amazon Music, or a physical CD. Keep the receipt.
2. Transcribe manually for personal rehearsal—do not distribute.
3. For projection or printed programs, contact Bandai Namco’s licensing department:
   Email: music.licensing@bandainamcoent.com
   Subject line: “Wedding Use Request – Immortal Love (English Version)”
   Include: Date, venue, expected audience size, and intended use (e.g., “printed in program for 80 guests”).
4. Alternative: Hire a string quartet or pianist who already holds a performance license through ASCAP/BMI. They can perform the melody, and you can recite a short excerpt (e.g., one stanza) under fair use for transformative purpose.

⚠️ Never assume “it’s just lyrics” = harmless. In 2023, a U.S. couple was invoiced $1,200 by a music publisher for printing unlicensed song lyrics in 150 wedding programs.

Comparing “Immortal Love” to Traditional Wedding Hymns

If legal simplicity matters more than thematic uniqueness, consider switching to a public domain alternative. But if “Immortal Love” is non-negotiable, proceed with licensing diligence.

Safe Alternatives That Capture the Same Mood

Want similar grandeur without legal risk? Try these public domain or Creative Commons options:

• “O Perfect Love” (text by Dorothy Gurney, 1885) – romantic, Victorian-era hymn
• “Jesu, Joy of Man’s Desiring” (Bach) – instrumental; no lyrics needed
• “Song of Songs 8:6–7” set to original music (write your own melody; biblical text is public domain)
• “Eternal Father, Strong to Save” – adaptable for secular vows with minor edits

All can be downloaded as PDFs from IMSLP.org or Hymnary.org with zero copyright concerns.

Conclusion

“immortal love wedding hymn lyrics pdf in english” is more than a search query—it’s a symbol of couples seeking deeply personal, narrative-driven ceremonies. But emotional resonance must be balanced with legal responsibility. The song’s beauty lies in its themes of enduring commitment, yet using it recklessly could invite consequences that undermine your special day. Prioritize verified sources, respect intellectual property, and when necessary, explore equally moving public domain alternatives. A truly immortal love deserves a foundation built on integrity—not shortcuts.

Telegram: https://t.me/+W5ms_rHT8lRlOWY5

Promocodes #Discounts #immortalloveweddinghymnlyricspdfinenglish